Skip to product information
1 of 1

Mouse IL-17A Protein, His tag

Mouse IL-17A Protein, His tag

Catalog Number: S0A4070 Reactivity: Mouse Conjugation: Unconjugated Brand: Starter
Price:
Regular price $140 USD
Regular price Sale price $140 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8), Il17a, Ctla8, Il17
Accession Q62386
Amino Acid Sequence

Protein sequence (Q62386, Thr22-Ala158, with C-His tag) TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Expression System HEK293
Molecular Weight Predicted MW: 17.1 kDa Observed MW: 17-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappa B and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Picture

Bioactivity

Immobilized Mouse IL-17A Protein, His tag at 2 μg/mL (100 μL/well) can bind Recombinant Mouse IL-17RA/CD217 Protein with EC50 of 23.6-35.6 ng/ml.

SDS-PAGE

2μg(R: reducing conditions)