Skip to product information
1 of 1

Mouse IL-1 beta/IL-1F2 protein, His tag

Mouse IL-1 beta/IL-1F2 protein, His tag

Catalog Number: S0A4043 Brand: Starter
Price:
Regular price $370 USD
Regular price Sale price $370 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Interleukin-1 beta, IL-1 beta, Il1b
Accession P10749
Amino Acid Sequence

Protein sequence (P10749, Val118-Ser269, with C-His tag)VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Expression System HEK293
Molecular Weight Predicted MW: 19.1 kDaObserved MW: 19.1 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. This cytokine is produced by activated macrophages, monocytes, and a subset of dentritic cells known as slanDC, as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. IL-1β, in combination with IL-23, induced expression of IL-17, IL-21 and IL-22 by γδ T cells. Over-expression of IL-1β caused by inflammasome may result in carcinogenesis. Higher osteoprotegerin and IL-1β levels are a characteristic of breast cancer cells with a higher metastatic potential.

Picture

SDS-PAGE

2 μg(R: reducing conditions)