Skip to product information
1 of 2

Mouse CD80, his tag

Mouse CD80, his tag

Catalog Number: S0A1069 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Activation B7-1 antigen (B7), B7
Accession Q00609
Amino Acid Sequence

Protein sequence (Q00609, Val38-Asn246, with C-10*His)VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 25.5 kDaObserved MW: 40-55 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution.1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The Cluster of differentiation 80 (also CD80 and B7-1) is a B7, type I membrane protein in the immunoglobulin superfamily, with an extracellular immunoglobulin constant-like domain and a variable-like domain required for receptor binding. It is closely related to CD86, another B7 protein (B7-2), and often works in tandem. Both CD80 and CD86 interact with costimulatory receptors CD28, CTLA-4 (CD152) and the p75 neurotrophin receptor. CD80 can be found on the surface of various immune cells, including B-cells, monocytes, or T-cells, but most typically at antigen-presenting cells (APCs) such as dendritic cells. CD80 has a crucial role in modulating T-cell immune function as a checkpoint protein at the immunological synapse.

Picture

Bioactivity

Immobilized Mouse CD80, his tag at 4 μg/mL (50 μL/well) can bind Recombinant Mouse CTLA-4 (C-Fc) with EC50 of 4.163-8.822 ng/ml.

SDS-PAGE

2μg(R: reducing conditions)