Skip to product information
1 of 1

LILRB1/CD85j/ILT2 His Tag Protein, Human

LILRB1/CD85j/ILT2 His Tag Protein, Human

Catalog Number: UA010090 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $600 USD
Regular price Sale price $600 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession Q8NHL6
Amino Acid Sequence Gly24-His458, with C-terminal 8*His GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHHHHHHHHH
Expression System HEK293
Molecular Weight 58-82kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS PH7.4
Reconstitution Reconstitute at 0.1-1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B1 (LILRB1) is a member of leukocyte Ig-like receptors (LILRs), also known as CD85j, ILT2, LIR1, and MIR7, contains four extracellular immunoglobulin domains, and four intracellular ITIMs. It is expressed on monocytes, macrophages, DCs, eosinophils and basophils, mB cells, T cells, and natural killer (NK) cells, as well as on in vitro cultured cord blood-derived progenitor mast cells and osteoclasts. LILRB1 and HLA-I molecule interactions are dependent on the non-polymorphic α3 domain of the heavy chain and β2 microglobulin. LILRB1 additionally interacts with the UL18 molecules from human cytomegalovirus (HCMV), which is an HLA-I homolog, RIFIN molecules from Plasmodium falciparum, Dengue virus through an unidentified ligand, and the damage associated molecular pattern proteins S100A8 and S100A9. Recent studies suggest that LILRB1 on tumor cells stimulates immune responses in certain situations.

Picture

SDS-PAGE

2μg (R: reducing condition, N: non-reducing condition).