Skip to product information
1 of 1

LCN2/NGAL His Tag, Human

LCN2/NGAL His Tag, Human

Catalog Number: S0A9039 Brand: Starter
Price:
Regular price $240 USD
Regular price Sale price $240 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen LCN2/NGAL
Synonyms Lipocalin-2, Oncogene 24p3, LCN2, HNL, NGAL
Accession P80188
Amino Acid Sequence

Gln21-Gly198, with C-terminal 8*His QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 26-28kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1. Biomed Pharmacother. 2021 Oct; 142:112002. doi: 10.1016/j.biopha.2021.112002. Epub 2021 Aug 27.

Background

Lipocalin-2 (LCN-2) is a novel, 198 amino acid adipocytokine also referred to as neutrophil gelatinase-associated lipocalin (NGAL). It was initially found in activated neutrophils, however, many other cells, like kidney tubular cells, may produce NGAL in response to various insults. NGAL, first known as an antibacterial factor of natural immunity, and an acute-phase protein. acting as an intracellular iron carrier and protecting MMP9 from proteolytic degradation, NGAL has a clear pro-tumoral effect, as has already been observed in different tumors (e g. breast, stomach, esophagus, brain) in humans. Recent studies have revealed that NGAL plays an important role in the physiopathology of chronic myeloid leukaemia (CML) mediated by BCR-ABL.

Picture

SDS-PAGE

1 μg (R: reducing conditions, N: non-reducing conditions).