Skip to product information
1 of 2

IL-3 Rα/CD123 His Tag Protein, Mouse

IL-3 Rα/CD123 His Tag Protein, Mouse

Catalog Number: UA010113 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $490 USD
Regular price Sale price $490 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Accession P26952-1
Amino Acid Sequence Ser17-Lys331, with C-terminal 8*His SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 45-65kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Interleukin-3 receptor α (IL-3Rα) is the α subunit of the ligand-specific IL-3R and initiates intracellular signaling in response to IL-3. The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. IL-3 amplifies proinflammatory signaling and cytokine storm in murine sepsis models. In vitro, IL-3 stimulation promoted IL-3Rα proteasomal degradation dependent on RNFT2 (RING finger transmembrane-domain containing protein 2, also TMEM118), and we identified IL-3Rα lysine 357 as a ubiquitin acceptor site. Researches identify RNFT2 as a negative regulator of IL-3Rα and show a potential role for the RNFT2/IL-3Rα/IL-3 axis in regulating innate immune responses in the lung.

Picture

Bioactivity

Anti-His antibody Immobilized on CM5 Chip captured IL-3 Rα/CD123 His Tag, Mouse (Cat. No. UA010113), can bind IL-3, Mouse (Cat. No. UA040064) with an affinity constant of 0.16μM as determined in SPR assay.

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).