Skip to product information
1 of 2

IL-13 Protein, Human

IL-13 Protein, Human

Catalog Number: UA040113 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $204 USD
Regular price Sale price $204 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms IL13, ALRH, BHR1, MGC116786, MGC116788, MGC116789, P600, Interleukin-13
Accession P35225
Amino Acid Sequence

Gly35-Asn146, with C-terminal 8*His GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFNGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 30-35kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Comparative Study Protein Expr Purif . 1998 Mar;12(2):239-48.

Background

Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. Interleukin 13 is a single-chain glycosylated polypeptide, which belongs to the IL-13/IL-4 family. IL-13 induces its effects through a multi-subunit receptor that includes the alpha chain of the IL-4 receptor (IL-4Rα) and at least one of two known IL-13-specific binding chains. Recent studies have shown that human interleukin-13 has many structural similarities with human interleukin-4 and is produced by gene replication events. As a cytokine, IL-13 protein is critical in regulating inflammatory, immune responses, and diseases.Also, it inhibits the production of pro-inflammatory cytokines and chemokines, and thus down-regulates macrophage activity.

Picture

Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells, the EC50 for this effect is less than 5ng/ml.

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).