Skip to product information
1 of 1

IgG1 Fc His Tag Protein, Human

IgG1 Fc His Tag Protein, Human

Catalog Number: UA050007 Application: Isotype control Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $314.00 SGD
Regular price Sale price $314.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P01857-1
Amino Acid Sequence EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Expression System HEK293
Molecular Weight 30-33 kDa(还原状态)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fc is a crystallizable fragment composed of the carboxyl terminal of two kinds of immunoglobulin heavy chain, which is connected to each other by disulfide bond. The Fc fragment contains the carboxyl terminal part of the heavy chain fixation region, which is responsible for the effect function of immunoglobulin (complement fixation, binding to the cell membrane through Fc receptors, and placental transport). It is reported that IgG1 Fc, as a potential anti-inflammatory drug, plays a new role in the treatment of human autoimmune diseases.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).