Immobilized Human IGFBP-4, His tag (Cat. No. S0A6002) at 2 μg/mL (50 μL/well) can bind Human IGF-2 Protein, hFc Tag with EC50 of 39.02-43.08 ng/ml.
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Insulin-like growth factor II, IGF-II, Somatomedin-A, T3M-11-derived growth factor, IGF2 |
| Accession | P01344 |
| Amino Acid Sequence | Protein sequence (P01344, Ala25-Glu91, with N-hFc tag)AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 34.6 kDaObserved MW: 40 kDa |
| Purity | >90% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Insulin-like growth factor 2 (IGF-2) is one of three protein hormones that share structural similarity to insulin. It has growth-regulating, insulin-like and mitogenic activities. It is believed to be a major fetal growth factor. The major role of IGF-2 is as a growth promoting hormone during gestation. IGF-2 exerts its effects by binding to the IGF-1 receptor and to the short isoform of the insulin receptor (IR-A or exon 11-). IGF-2 may also bind to the IGF-2 receptor (also called the cation-independent mannose 6-phosphate receptor), which acts as a signalling antagonist. IGF-2 acts as a co-hormone together with both FSH and LH. IGF-2 is sometimes produced in excess in islet cell tumors and non-islet hypoglycemic cell tumors, causing hypoglycemia. Loss of imprinting of IGF-2 is a common feature in tumors seen in Beckwith-Wiedemann syndrome. As IGF-2 promotes development of fetal pancreatic beta cells, it is believed to be related to some forms of diabetes mellitus.
Picture
Picture
Bioactivity
SDS-PAGE
2 μg(R: reducing conditions)
