Skip to product information
1 of 2

IFN-γ His Tag Protein, Rat

IFN-γ His Tag Protein, Rat

Catalog Number: UA019015 Brand: UA BIOSCIENCE
Price:
Regular price $160 USD
Regular price Sale price $160 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Rat
Synonyms Interferon gamma, IFN-gamma, Ifng
Accession P01581
Amino Acid Sequence

Protein sequence (P01581, Met1-Cys156, with C-His tag)MSATRRVLVLQLCLMALSGCYCQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Expression System HEK293
Molecular Weight

Predicted MW: 19.6 kDaObserved MW: 19-25 kDa

Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interferon gamma (IFNG or IFN-γ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. Through cell signaling, interferon gamma plays a role in regulating the immune response of its target cell. A key signaling pathway that is activated by type II IFN is the JAK-STAT signaling pathway. IFNG plays an important role in both innate and adaptive immunity. Type II IFN is primarily secreted by adaptive immune cells, more specifically CD4+ T helper 1 (Th1) cells, natural killer (NK) cells, and CD8+ cytotoxic T cells. The expression of type II IFN is upregulated and downregulated by cytokines. By activating signaling pathways in cells such as macrophages, B cells, and CD8+ cytotoxic T cells, it is able to promote inflammation, antiviral or antibacterial activity, and cell proliferation and differentiation. Type II IFN has played a role in the development of cancer immunotherapy treatments due to its ability to prevent tumor growth.

Picture

Bioactivity

Immobilized Rat IFN-γ Protein, His tag at 4 μg/mL (50 μL/well) can bind Recombinant Mouse IFNGR1 (C-Fc) with EC50 of 28.22-36.34 ng/ml.

SDS-PAGE

2 μg(R: reducing conditions)