Skip to product information
1 of 2

Human PlGF Protein, His Tag

Human PlGF Protein, His Tag

Catalog Number: S0A0018 Brand: Starter
Price:
Regular price $355 USD
Regular price Sale price $355 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms PLGF
Accession P49763-2
Amino Acid Sequence

Protein sequence (P49763-2, Leu19-Arg149, with C-His Tag) LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

Expression System HEK293
Molecular Weight Predicted MW: 16.4 kDaObserved MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Placental Growth Factor (PIGF) is a key angiogenic protein belonging to the vascular endothelial growth factor (VEGF) family. It is primarily produced by the placenta and is crucial for normal placental vascular development during pregnancy. Unlike VEGF-A, PIGF specifically binds to the VEGFR-1 receptor, modulating vascular growth and inflammation. Its levels are typically low in healthy adults but significantly elevated in pre-eclampsia, a serious pregnancy complication, making it a critical diagnostic biomarker. Beyond obstetrics, PIGF is implicated in pathological angiogenesis, such as in cancer and ischemic diseases, where it promotes blood vessel growth, positioning it as a potential therapeutic target in these conditions.

Picture

Bioactivity

Immobilized Human PIGF Protein, His Tag at 10 μg/mL (100 μL/well) can bind Recombinant Human VEGFR1 (C-Fc) with EC50 of 15.9-18.4 ng/ ml.

SDS-PAGE

2μg(R: reducing conditions)