Human PD-L1, His Tag
Human PD-L1, His Tag
Product Details
Product Details
Product Specification
| Species | Human |
| Accession | Q9NZQ7 |
| Amino Acid Sequence | FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 33kDa Actual: 37kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | 0.2M PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ ，Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Background
PD-L1 (programmed death ligand 1) is one of the ligands of programmed cell death protein 1(PD-1), which is involved in the negative regulation of immune response and is an important immune checkpoint molecule.PD-L1 can recognize and bind to PD1 expressed on activated lymphocytes to induce apoptosis or prevent the normal progression of cell cycle, thus inhibiting the continuous T cell response, promoting antigen-specific T cell apoptosis and further promoting the occurrence and development of tumors.PD-1 /PD-L1 inhibitors have shown significant clinical efficacy in melanoma, lung cancer, liver cancer and other tumors, which is of great significance for the research and treatment of human autoimmune diseases and tumors.This product is the recombinant human PD-L1 protein expressed from human 293 cells (HEK293).
Picture
Picture
SDS-PAGE
