2μg(R: reducing conditions)
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Differentiation-stimulating factor (D factor), Melanoma-derived LPL inhibitor (MLPLI), HILDA |
| Accession | P15018 |
| Amino Acid Sequence | Protein sequence (P15018, Met1-Phe202, with C-10*His)MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 23.7 kDaObserved MW: 33-43 kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.6 months, -20 to -70 °C under sterile conditions after reconstitution.1 week, 2 to 8 °C under sterile conditions after reconstitution.Please avoid repeated freeze-thaw cycles. |
Background
Leukemia inhibitory factor, or LIF, is an interleukin 6 class cytokine that affects cell growth by inhibiting differentiation. When LIF levels drop, the cells differentiate. LIF derives its name from its ability to induce the terminal differentiation of myeloid leukemic cells, thus preventing their continued growth. Other properties attributed to the cytokine include: the growth promotion and cell differentiation of different types of target cells, influence on bone metabolism, cachexia, neural development, embryogenesis and inflammation. It has been suggested that recombinant human LIF might help to improve the implantation rate in women with unexplained infertility. LIF is often added to stem cell culture media as an alternative to feeder cell culture, due to the limitation that feeder cells present by only producing LIF on their cell surfaces. LIF promotes self-renewal by recruiting signal transducer and activator of transcription 3 (Stat3).
Picture
Picture
SDS-PAGE
