Immobilized Human IgG3 Fc Protein at 4 μg/mL (50 μL/well) can bind Human Fc γ RIa/CD64, His tag (Cat. No. S0A1105) with EC50 of 4.609-5.713 ng/ml.
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Immunoglobulin heavy constant gamma 3, HDC, Heavy chain disease protein, Ig gamma-3 chain C region, IGHG3 |
| Accession | P01860 |
| Amino Acid Sequence | Protein sequence (P01860, Glu99-Lys377)ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 31.2 kDaObserved MW: 40-45 kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | No Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Immunoglobulin G (IgG) is the most common type of antibody found in blood circulation. IgG molecules are created and released by plasma B cells. Each IgG antibody has two paratopes. Antibodies are major components of humoral immunity. IgG is the main type of antibody found in blood and extracellular fluid, allowing it to control infection of body tissues. By binding many kinds of pathogens such as viruses, bacteria, and fungi, IgG protects the body from infection. IgG3 (and IgE) appear early in a response. The IgG3, though of relatively low affinity, allows IgG-mediated defences to join IgM-mediated defences in clearing foreign antigens.
Picture
Picture
Bioactivity
SDS-PAGE
2 μg(R: reducing conditions)
