Skip to product information
1 of 2

Human IgG2 Fc

Human IgG2 Fc

Catalog Number: S0A0053 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Ig gamma-2 chain C region, Ig gamma-2 chain C region DOT, Ig gamma-2 chain C region TIL, Ig gamma-2 chain C region ZIE
Accession P01859
Amino Acid Sequence

Protein sequence(P01859, Glu99-Lys326(V161M, S257A), no tag)ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGMEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:25.7kDa Actual:30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag No Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The fragment crystallizable region (Fc region) is the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. This property allows antibodies to activate the immune system. Fc binds to various cell receptors and complement proteins. In this way, it mediates different physiological effects of antibodies (detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes).

Picture

Bioactivity

Immobilized Human IgG2 Fc at 20 μg/mL (50 μL/well) can bind Staphylococcus aureus Protein A (B), His tag (Cat. No. S0A0109) with EC50 of 12.95-15.57 ng/ ml.

SDS-PAGE

2μg(R: reducing conditions)