Skip to product information
1 of 2

Human FSH alpha&FSH beta/CGA&FSHB protein, No tag&His tag

Human FSH alpha&FSH beta/CGA&FSHB protein, No tag&His tag

Catalog Number: S0A8011 Brand: Starter
Price:
Regular price $310 USD
Regular price Sale price $310 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Follicle Stimulating Hormone, Follitropin, FSH
Accession P01215、P01225
Amino Acid Sequence

Protein sequence1 (P01215, Ala25-Ser116)APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS; 

Protein sequence2 (P01225, Asn19-Glu129, with C-His tag)NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Expression System HEK293
Molecular Weight

Predicted MW: 10.2 kDa(CGA)&14.2 kDa(FSHB);Observed MW: 20-25 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag (FSHB)&No tag (CGA)
Physical Appearance Lyophilized powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Follicle-stimulating hormone (FSH) is a gonadotropin, a glycoprotein polypeptide hormone. FSH is synthesized and secreted by the gonadotropic cells of the anterior pituitary gland and regulates the development, growth, pubertal maturation, and reproductive processes of the body. FSH and luteinizing hormone (LH) work together in the reproductive system. FSH is a 35.5 kDa glycoprotein heterodimer, consisting of two polypeptide units, alpha and beta. The alpha subunits of the glycoproteins LH, FSH, TSH, and hCG are identical and consist of 96 amino acids, while the beta subunits vary. Both subunits are required for biological activity. FSH has a beta subunit of 111 amino acids (FSH β), which confers its specific biologic action, and is responsible for interaction with the follicle-stimulating hormone receptor. The sugar portion of the hormone is covalently bonded to asparagine, and is composed of N-acetylgalactosamine, mannose, N-acetylglucosamine, galactose, and sialic acid.

Picture

Bioactivity

Immobilized Human FSH alpha&FSH beta/CGA&FSHB protein, No tag&His tag at 2 μg/mL (50 μL/well) can bind FSHB Recombinant Rabbit mAb (SDT-R287) (Cat. No. S0B2272) with EC50 of 22-38 ng/mL.

SDS-PAGE

2 μg(R: reducing conditions; NR: non-reducing conditions)