Skip to product information
1 of 1

Human ECP/Ribonuclease 3 Protein, His Tag

Human ECP/Ribonuclease 3 Protein, His Tag

Catalog Number: S0A6057 Brand: Starter
Price:
Regular price $170 USD
Regular price Sale price $170 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Eosinophil cationic protein, RNase 3, RNS3
Accession P12724
Amino Acid Sequence

Protein sequence (P12724, Arg28-Ile160, with C-His Tag) RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Expression System HEK293
Molecular Weight Predicted MW: 17.2 kDaObserved MW: 25-35 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Ribonuclease 3, commonly known as Drosha, is a Class 2 ribonuclease III enzyme crucial for microRNA (miRNA) biogenesis. Located in the nucleus, it functions as the core catalytic component of the Microprocessor complex. Its primary role is to initiate miRNA processing by cleaving long primary miRNA transcripts (pri-miRNAs) into approximately 70-nucleotide precursor miRNAs (pre-miRNAs). This precise endonucleolytic cleavage is the first and essential step in the miRNA maturation pathway, which ultimately regulates gene expression post-transcriptionally. Dysregulation of Drosha is implicated in various cancers and developmental disorders.

Picture

SDS-PAGE

2μg(R: reducing conditions)