Skip to product information
1 of 1

Human CY211, His Tag

Human CY211, His Tag

Catalog Number: S0A0007 Brand: Starter
Price:
Regular price $350 USD
Regular price Sale price $350 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Cy211
Accession P08727
Amino Acid Sequence

Protein sequence(P08727, Ser239-Leu400 with C-10*His)


SAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 20kDa Actual: 22kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Cytokeratin 19 fragment antigen (Cy211) belongs to a cytokeratin family, which is normally expressed in epithelial tissues and forms the epithelial cells’ filament cytoskeleton. Cy211 is useful as a tumor marker, especially for non-small cell lung cancer (NSCLC) along with carcinoembryonic antigen (CEA) and squamous cell carcinoma–associated antigen (SCC), but also for other epithelial tumors such as bladder cancer. This elevation in tumors may be due to cell lysis, releasing cell contents to the blood, including Cy211 by the action of proteases that degrade the cytokeratin filaments 

Picture

SDS-PAGE

2μg (R: reducing conditions)