Skip to product information
1 of 1

Human CHOP/DDIT3 Protein, His tag

Human CHOP/DDIT3 Protein, His tag

Catalog Number: S0A9060 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms DNA damage-inducible transcript 3 protein, DDIT-3, C/EBP zeta, C/EBP-homologous protein (CHOP), C/EBP-homologous protein 10 (CHOP-10), CCAAT/enhancer-binding protein homologous protein, Growth arrest and DNA damage-inducible protein GADD153, CHOP10, GADD153
Accession P35638
Amino Acid Sequence

Protein sequence (P35638, Met1-Ala169, with C-His tag) MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA

Expression System HEK293
Molecular Weight

Predicted MW: 20.9 kDa Observed MW: 33-40 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

DNA damage-inducible transcript 3, also known as C/EBP homologous protein (CHOP), is a pro-apoptotic transcription factor that is encoded by the DDIT3 gene. It is a member of the CCAAT/enhancer-binding protein (C/EBP) family of DNA-binding transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis and has an important role in the cell's stress response. The regulation of CHOP expression plays an important role in metabolic diseases and in some cancers through its function in mediating apoptosis.

Picture

SDS-PAGE

2μg(R: reducing conditions)