Skip to product information
1 of 1

Human CGA&TSHB protein, No tag&His tag

Human CGA&TSHB protein, No tag&His tag

Catalog Number: S0A8010 Brand: Starter
Price:
Regular price $250 USD
Regular price Sale price $250 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Thyroid-stimulating hormone, Thyrotropin, TSH
Accession P01215、P01222
Amino Acid Sequence

Protein sequence1 (P01215, Ala25-Ser116)APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS; 

Protein sequence2 (P01222, Phe21-Val138, with C-His tag)FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV

Expression System HEK293
Molecular Weight Predicted MW: 10.2 kDa(CGA)&15.2 kDa(TSHB)Observed MW: 17-20 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag (TSHB)&No tag (CGA)
Physical Appearance Lyophilized powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Thyroid-stimulating hormone (TSH) is a pituitary hormone that stimulates the thyroid gland to produce thyroxine (T4), and then triiodothyronine (T3) which stimulates the metabolism of almost every tissue in the body. It is a glycoprotein hormone produced by thyrotrope cells in the anterior pituitary gland, which regulates the endocrine function of the thyroid. TSH consists of two subunits, the alpha and the beta subunit. The α subunit is thought to be the effector region responsible for stimulation of adenylate cyclase (involved the generation of cAMP). The β (beta) subunit (TSHB) is unique to TSH, and therefore determines its receptor specificity. The TSH receptor is found mainly on thyroid follicular cells. Stimulation of the receptor increases T3 and T4 production and secretion.

Picture

SDS-PAGE

2 μg(R: reducing conditions; NR: non-reducing conditions)