Skip to product information
1 of 1

Human CDKN2B/p15INK4b Protein, His tag

Human CDKN2B/p15INK4b Protein, His tag

Catalog Number: S0A9061 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Cyclin-dependent kinase 4 inhibitor B, Multiple tumor suppressor 2 (MTS-2), p14-INK4b, p15-INK4b (p15INK4B), MTS2
Accession P42772
Amino Acid Sequence

Protein sequence (P42772, Met1-Asp138, with C-His tag) MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

Expression System E.coli
Molecular Weight Predicted MW: 16.4 kDa Observed MW: 16.4 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Cyclin-dependent kinase 4 inhibitor B also known as multiple tumor suppressor 2 (MTS-2) or p15INK4b is a protein that is encoded by the CDKN2B gene in humans. This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated, deleted, or dysregulated in a wide variety of cancer. This gene encodes a cyclin-dependent kinase inhibitor, also known as p15Ink4b protein, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases by cyclin D, thus the encoded protein functions as a cell growth regulator that inhibits cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. CDKN2B tumor suppressor gene product p15 has been shown to interact with cyclin-dependent kinase 4.

Picture

SDS-PAGE

2μg(R: reducing conditions)