Skip to product information
1 of 1

Human CDKN2A/p16INK4a, His tag

Human CDKN2A/p16INK4a, His tag

Catalog Number: S0A6041 Brand: Starter
Price:
Regular price $75 USD
Regular price Sale price $75 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Cyclin-dependent kinase 4 inhibitor A (CDK4I), Multiple tumor suppressor 1 (MTS-1), p16-INK4a (p16-INK4; p16INK4A), CDKN2, MTS1
Accession P42771
Amino Acid Sequence

Protein sequence (P42771, Met1-Asp156, with C-10*His)MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPDGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 18.2 kDaObserved MW: 18.2 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.6 months, -20 to -70 °C under sterile conditions after reconstitution.1 week, 2 to 8 °C under sterile conditions after reconstitution.Please avoid repeated freeze-thaw cycles.

Background

CDKN2A, also known as cyclin-dependent kinase inhibitor 2A, is ubiquitously expressed in many tissues and cell types. The gene codes for two proteins, including the INK4 family member p16 (or p16INK4a) and p14arf. Both act as tumor suppressors by regulating the cell cycle. p16 inhibits cyclin dependent kinases 4 and 6 (CDK4 and CDK6) and thereby activates the retinoblastoma (Rb) family of proteins, which block traversal from G1 to S-phase. Somatic mutations of CDKN2A are common in the majority of human cancers, with estimates that CDKN2A is the second most commonly inactivated gene in cancer after p53. Germline mutations of CDKN2A are associated with familial melanoma, glioblastoma and pancreatic cancer. The CDKN2A gene also contains one of 27 SNPs associated with increased risk of coronary artery disease.

Picture

SDS-PAGE

2 μg(R: reducing conditions)