Skip to product information
1 of 2

Human CD66b, His tag

Human CD66b, His tag

Catalog Number: S0A1010 Brand: Starter
Price:
Regular price $150 USD
Regular price Sale price $150 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CEAM8, CD67 antigen, Carcinoembryonic antigen CGM6, Non-specific cross-reacting antigen NCA-95
Accession P31997
Amino Acid Sequence

Protein sequence(P31997, Met1-Ile349, with C-10*His)
MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 39.8kDa Actual: 60-80kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

CD66b is a GPI-anchored glycoprotein of the carcinoembryonic antigen (CEA) family and is located in the specific granules . It is only known to be expressed on human granulocytes and on the granulocytes of two primate species and is associated with the aggregate formation of human neutrophils , Findings suggest that these molecules may play a role in phagocytosis, chemotaxis and adherence.

Picture

Bioactivity

Immobilized CEACAM-6/CD66c Fc Chimera, Human (UA010274) at 10 μg/mL (50 μL/well) can bind Human CD66b, His tag with EC50 of 0.081-0.114 μg/mL.

SDS-PAGE

2μg(R: reducing conditions)