Skip to product information
1 of 1

Human CD37 Protein, hFc tag

Human CD37 Protein, hFc tag

Catalog Number: S0A1130 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $185 USD
Regular price Sale price $185 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Leukocyte antigen CD37, Tetraspanin-26 (Tspan-26), TSPAN26
Accession P11049
Amino Acid Sequence

Protein sequence (P11049, Arg112-Asn241, with C-hFc tag) RAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN

Expression System HEK293
Molecular Weight Predicted MW: 41.0 kDa Observed MW: 54-56 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Leukocyte antigen CD37 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic transmembrane domains. Tetraspanins mediate signal transduction events that play a role in the regulation of immune responses, cell development, activation, growth and motility. CD37 expression is restricted to cells of the immune system, with highest abundance on mature B cells, and lower expression is found on T cells and myeloid cells. CD37 is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. CD37 controls both humoral and cellular immune responses.

Picture

SDS-PAGE

2 μg(R: reducing conditions)