Immobilized Human CD326/EPCAM Protein, His Tag at 2 μg/mL (100 μL/well) can bind CD326 Recombinant Rabbit mAb (S-1009-76) (Cat. No. S0B2316) with EC50 of 1.3-2.2 ng/mL.
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1/4 antigen, KSA, Major gastrointestinal tumor-associated protein GA733-2, Tumor-associated calcium signal transducer 1, Ep-CAM, GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1 |
| Accession | P16422 |
| Amino Acid Sequence | Protein sequence (P16422, Gln24-Lys265, with C-His Tag) QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
| Expression System | CHO |
| Molecular Weight | Predicted MW: 29.1 kDaObserved MW: 33 kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell–cell adhesion in epithelia. EpCAM is also involved in cell signaling, migration, proliferation, and differentiation. Additionally, EpCAM has oncogenic potential via its capacity to upregulate c-myc, e-fabp, and cyclins A & E. Since EpCAM is expressed exclusively in epithelia and epithelial-derived neoplasms, EpCAM can be used as diagnostic marker for various cancers. It appears to play a role in tumorigenesis and metastasis of carcinomas, so it can also act as a potential prognostic marker and as a potential target for immunotherapeutic strategies. EpCAM is often overexpressed in certain carcinomas, including in breast cancer, colon cancer and basal cell carcinoma of the skin. A problem in EpCAM can indirectly cause Lynch syndrome, a genetic disorder that leads to increased risk of cancer. Mutations in EpCAM have also been associated with congenital tufting enteropathy which causes intractable diarrhea in newborn children.
Picture
Picture
Bioactivity
SDS-PAGE
2μg(R: reducing conditions)
