Skip to product information
1 of 1

Human B7-H6, His tag

Human B7-H6, His tag

Catalog Number: S0A6036 Brand: Starter
Price:
Regular price $150 USD
Regular price Sale price $150 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms B7 homolog 6 (B7-H6), B7H6
Accession Q68D85
Amino Acid Sequence

Protein sequence (Q68D85, Asp25-Ser262, with C-10*His) DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 28.4 kDa Observed MW: 35-55 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

B7-H6 is a glycosylated member of the B7 family of immune co-stimulatory proteins. Mature human B7-H6 consists of a 238 amino acid (aa) extracellular domain (ECD) that contains one Ig-like V domain and one Ig-like C1 domain, a 21 aa transmembrane segment, and a 171 aa cytoplasmic domain. The Ig-like V domain mediates 1:1 stoichiometric binding of B7-H6 to NKp30 expressed on NK cells. Ligation of NKp30 by B7-H6 induces NK cell activation and target cell cytolysis. B7-H6 is expressed on a wide range of hematopoietic, carcinoma, and melanoma tumor cells, which is consistent with the detection of NKp30 binding sites on many tumors. The expression of NKp30 ligands on tumor cells correlates with tumor cell sensitivity to NKp30‑dependent cell lysis. B7-H6 is expressed in several tumor cell lines, both in vitro and in vivo, including esophageal squamous cell carcinoma, oral squamous cell carcinoma and breast cancer. but remains undetected in healthy cells thus far, and is therefore an excellent tumor marker.

Picture

Bioactivity

Immobilized Human B7-H6, His tag at 20 μg/mL (50 μL/well) can bind NKp30/CD337 Fc Chimera, Human (UA010046) with EC50 of 0.014-0.022 μg/ml.

SDS-PAGE

2μg(R: reducing conditions)