Skip to product information
1 of 1

Human Angiotensin Converting Enzyme 1 Protein, His tag

Human Angiotensin Converting Enzyme 1 Protein, His tag

Catalog Number: S0A1150 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $250 USD
Regular price Sale price $250 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Angiotensin-converting enzyme, ACE, Dipeptidyl carboxypeptidase I, Kininase II, CD143, DCP, DCP1
Accession P12821
Amino Acid Sequence

Protein sequence (P12821, Pro631-Arg1232, with C-His tag) PLPDNYPEGIDLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSAR

Expression System HEK293
Molecular Weight Predicted MW: 71.1 kDa Observed MW: 95 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Angiotensin - converting enzyme (ACE) is a crucial enzyme in the body's renin - angiotensin - aldosterone system (RAAS). It plays a key role in regulating blood pressure and fluid balance. ACE is mainly found in the lungs, but is also present in other tissues. Functionally, ACE converts angiotensin I into angiotensin II, a powerful vasoconstrictor. Angiotensin II causes blood vessels to narrow, increasing peripheral resistance and thus raising blood pressure. Additionally, it stimulates the release of aldosterone from the adrenal glands, which promotes sodium and water reabsorption in the kidneys, further contributing to blood volume and pressure regulation. Dysregulation of ACE activity can lead to hypertension and other cardiovascular disorders, making it an important target for drugs like ACE inhibitors in treating such conditions.

Picture

SDS-PAGE

2μg(R: reducing conditions)