Skip to product information
1 of 2

FGL2 His Tag Protein, Cynomolgus

FGL2 His Tag Protein, Cynomolgus

Catalog Number: UA010363 Reactivity: Cynomolgus Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $608 USD
Regular price Sale price $608 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Cynomolgus
Synonyms FGL2, T49, pT49
Accession A0A2K5WID3
Amino Acid Sequence Pro204-Pro439, with C-terminal 8*His PVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNRSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVKLYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKPGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 36-42kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Feng Y. et al. (2020) Fibrinogen-Like Protein 2 (FGL2) is a Novel Biomarker for Clinical Prediction of Human Breast Cancer. Med Sci Monit. 26: e923531.

2、Hou X. et al. (2021) Regulatory T cells induce polarization of pro-repair macrophages by secreting sFGL2 into the endometriotic milieu. Commun Biol. 4(1): 499.

Background

Fibrinogen-like protein 2 (FGL2) is a member of the fibrinogen-like protein family and possesses important regulatory functions in both innate and adaptive immune responses. Fibrinogen-like protein 2 (FGL2) exists in both soluble and membrane forms. Soluble fibrinogen-like protein 2 (sFGL2) has been recently identified as a novel effector molecule of Tregs and plays a pivotal role in regulating both innate and adaptive immunity. FGL2 mediates its immunosuppressive activity by binding to inhibitory FcγRIIB (CD32B) receptors expressed by antigen presenting cells (APC), including dendritic cells (DC) and B cells, and thus sFGL2 may inhibit the maturation of DC, resulting in the suppression of effector T cell responses and inducing apoptosis of B cells.

Picture

Bioactivity

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).