Skip to product information
1 of 4

EPHB3 Protein

EPHB3 Protein

Catalog Number: UA080084 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $767 USD
Regular price Sale price $767 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms ETK2, HEK2, TYRO6
Accession P54753
Amino Acid Sequence

K596-V998(end)

KLQQYIAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV

Expression System Baculovirus-InsectCells
Molecular Weight 72.2 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 20mM Reduced Glu, 1mM DTT, 10% Glycerol, 0.05% Brij-35, 0.1mM PMSF, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Picture

Bioactivity

EPHB3 titration in HTRF assay

The EPHB3 activity was detected using HTRF technology. The reaction was performed by incubating the EPHB3 protein , ATP and substrate at 25℃ for 60 min, adding the beads at 25℃ for 60 min, then reading ratio 665/620 with BMG.

SDS-PAGE

SEC-HPLC