Skip to product information
1 of 4

EPHA3 Protein

EPHA3 Protein

Catalog Number: UA080078 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $767 USD
Regular price Sale price $767 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P29320-1
Amino Acid Sequence

K579-V983(end)

KRLHFGNGHLKLPGLRTYVDPHTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKIISSIKALETQSKNGPVPV


Expression System Baculovirus-InsectCells
Molecular Weight 71.9 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 1mM DTT, 10% Glycerol, 0.05% Briji-35, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Picture

Bioactivity

EPHA3 titration in HTRF assay

The EPHA3 activity was detected using homogeneous time-resolved fluorescence technology. The reaction was performed by incubating the EPHA3 protein , ATP and substrate at 25℃ for 50 min, adding the TK-mix at 25℃ for 60 min, then reading ratio 665/620 nm with BMG.

SDS-PAGE

SEC-HPLC