Skip to product information
1 of 2

Cynomolgus IL-6 Protein, His Tag

Cynomolgus IL-6 Protein, His Tag

Catalog Number: S0A4085 Brand: Starter
Price:
Regular price $135 USD
Regular price Sale price $135 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Cynomolgus
Synonyms Interleukin-6, IL6
Accession P79341
Amino Acid Sequence

Protein sequence (P79341, Ala28-Met212, with C-His Tag) APVLPGEDSKDVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Weight Predicted MW: 22.7 kDaObserved MW: 24-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. Osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. IL-6 stimulates the inflammatory and auto-immune processes in many diseases such as multiple sclerosis, diabetes, atherosclerosis, depression, Alzheimer's disease, systemic lupus erythematosus, multiple myeloma, prostate cancer, rheumatoid arthritis, and intracerebral hemorrhage.

Picture

Bioactivity

Immobilized Cynomolgus IL-6 Protein, His Tag at 5 μg/mL (100 μL/well) can bind Biotinylated IL-6 R alpha/CD126 Fc&Avi Tag Protein, Human (UA011222) with EC50 of 17.13-29.83 ng/ml.

SDS-PAGE

2μg(R: reducing conditions)