Skip to product information
1 of 2

CD79A His Tag Protein, Human

CD79A His Tag Protein, Human

Catalog Number: UA010317 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $520 USD
Regular price Sale price $520 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CD79A, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein
Accession P11912
Amino Acid Sequence

Leu33-Arg143, with C-terminal 8*His LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

35-46kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Venkitaraman A R. et al. (1991) The B-cell antigen receptor of the five immunoglobulin classes. Nature. 352(6338): 777-781.

2、Kim K M. et al. (1993) Signalling function of the B-cell antigen receptors. Immunol Rev. 132: 125-146.

Background

CD79A encodes CD79a (also known as Ig-α) belonging to the Ig superfamily, a transmembrane protein that associate with CD79a(Ig-β) via a disulfide bond. CD79A and CD79B encoded by the mb-1 and B29 genes, respectively. CD79A and CD79B are proximal B-cell receptor subunits that contain an immunoreceptor tyrosine-based activation motif (ITAM) that frequently harbors somatic mutations. Ig-α and Ig-β form a disulfide-linked heterodimer that associates with membrane-bound Ig (mIg)3 molecules of every Ig class to form the B cell Ag receptor (BCR) complex. The variable region of the H and L (IgH and IgL) chains of the mIg molecules constitute the Ag-binding portion of the BCR, whereas the Ig-α/Ig-β heterodimer is its signaling component.

Picture

SDS-PAGE

1 μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized CD79A His Tag Protein, Human (Cat. No. UA010317) at 2.0μg/mL (100μL/well) can bind CD79a/MB-1 Recombinant Rabbit mAb (SDT-030-18) (Cat. No. S0B2200) with EC50 of 1.57-2.04ng/mL.