Skip to product information
1 of 1

Canine CD4, his tag

Canine CD4, his tag

Catalog Number: S0A1061 Brand: Starter
Price:
Regular price $60 USD
Regular price Sale price $60 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Canine
Synonyms T-cell surface antigen T4/Leu-3
Amino Acid Sequence

Protein sequence (P33705, Val25-Lys401, with C-10*His) VREVVLGKAGDAVELPCQTSQKKNIHFNWRDSSMVQILGNQGSFWTVGSSRLKHRVESKKNLWDQGSFPLVIKDLEVADSGIYFCDTDKRQEVELLVFNLTAKWDSGSSSGSSNIRLLQGQQLTLTLENPSGSSPSVQWKGPGNKSKHGGQNLSLSWPELQDGGTWTCIISQSQKTVEFNINVLVLAFQKVSNTFYAREGDQVEFSFPLSFEDENLVGELRWQAQGASSSLLWISFTLENRKLSMKEAHAPLKLQMKESLPLRFTLPQVLSRYAGSGILTLNLAKGTLYQEVNLVVMRANSSQNNLTCEVLGPTSPELTLSLNLKEQAAKVSKQQKLVWVVDPEGGTWQCLLSDKDKVLLASSLNVSSPVVIKSWPKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 43.4 kDa Observed MW: 50, 54 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD4 (cluster of differentiation 4) is a glycoprotein that serves as a co-receptor for the T-cell receptor (TCR). CD4 is found on the surface of immune cells such as T helper cells, monocytes, macrophages, and dendritic cells. It was discovered in the late 1970s and was originally known as leu-3 and T4 (after the OKT4 monoclonal antibody that reacted with it) before being named CD4 in 1984. CD4+ T helper cells are white blood cells that are an essential part of the human immune system. They are often referred to as CD4 cells, T-helper cells or T4 cells. They are called helper cells because one of their main roles is to send signals to other types of immune cells, including CD8 killer cells, which then destroy the infectious particle.

Picture

SDS-PAGE

2μg(R: reducing conditions)