Skip to product information
1 of 3

Biotinylated IL-15R alpha/CD215 Fc&Avi Tag Protein, Human

Biotinylated IL-15R alpha/CD215 Fc&Avi Tag Protein, Human

Catalog Number: UA010693 Reactivity: Human Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $560 USD
Regular price Sale price $560 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms IL-15RA, IL-15R-alpha, Interleukin-15 Receptor Subunit Alpha, CD215
Accession Q13261-1
Amino Acid Sequence

Ile31-Thr205, with C-terminal human IgG1 Fc &Avi tag ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

72-80kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, Mouse Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Clémentine Perrier , Ingrid Arijs, Dominiek Staelens, Christine Breynaert, Isabelle Cleynen, Kris Covens, Marc Ferrante, Gert Van Assche, Séverine Vermeire, Gert de Hertogh, Frans Schuit, Paul Rutgeerts, Jan L Ceuppens. (2013) Interleukin-15 receptor α expression in inflammatory bowel disease patients before and after normalization of inflammation with infliximab. mmunology. 138(1):47-56.

Background

IL-15Ra chain is expressed by many cell types including monocytes, dendritic cells, natural killer cells, T cells and fibroblasts. Several isoforms of IL-15Ra exist and are generated either by alternative splicing or by proteolytic cleavage. Hence, IL-15Ra can be found as a membrane receptor or as a soluble receptor (sIL-15Ra); and as most isoforms of the receptor contain a sushi domain allowing very-high-affinity binding of IL-15, signaling or regulatory functions can be attributed to the receptor. Competition between soluble and membrane receptors can result in reduced biological activity of IL-15, though a super agonist effect of the soluble form was also observed. The signaling of IL-15 appears more complicated than for other cytokines because IL-15 primarily exists as a complex bound to IL-15Ra. When IL-15/IL-15Ra complexes are shuttled to the cell surface, they can stimulate opposing cells through the b/cC receptor complex (trans-presentation), or alternatively may allow an autocrine stimulation (cis-presentation).

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

SEC-HPLC

SEC>90%

ELISA

Immobilized IL-15 Protein, Human (Cat. No. UA040010) at 2μg/mL (100μL/well) can bind Biotinylated IL-15R alpha/CD215 Fc&Avi Tag Protein, Human (Cat. No. UA010693) with EC50 of 24.54-33.95ng/ml.