Skip to product information
1 of 1

Biotinylated Fc γ RIIB/CD32b Avi&His Tag Protein, Human

Biotinylated Fc γ RIIB/CD32b Avi&His Tag Protein, Human

Catalog Number: UA010563 Reactivity: Human Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $557 USD
Regular price Sale price $557 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen Fc γ RIIB/CD32b
Synonyms FCGR2B/C, CD32b/c, Fc RII-b/c, Fc-gamma RII-b/c, CD32, FCG2, IGFR2, CDw32
Accession P31994-1
Amino Acid Sequence

Ala46-Pro217, with C-terminal Avi&His Tag APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPGGGSGLNDIFEAQKIEWHEHHHHHHHH

Expression System HEK293
Molecular Weight 29-32kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Christopher T. Rankin, Maria-Concetta Veri, Sergey Gorlatov, Nadine Tuaillon, Steve Burke, Ling Huang, H. David Inzunza, Hua Li, Shannon Thomas, Syd Johnson, Jeffrey Stavenhagen, Scott Koenig, Ezio Bonvini: CD32B, the human inhibitory Fc-γ receptor IIB, as a target for monoclonal antibody therapy of B-cell lymphoma, Blood (2006) 108 (7): 2384-2391.

Background

IgG Fc region receptors are members of the Ig superfamily that play roles in activating or inhibiting immune responses such as degranulation, phagocytosis, ADCC, cytokine release, and B-cell proliferation. There are three genes for human Fc γ RII /CD32 (A, B, and C) and one for mouse Fc γ RII B (CD32B). CD32 is a low affinity receptor for IgG. CD32B is expressed on B cells and myeloid dendritic cells. Ligation of CD32B on B cells downregulates antibody production and may, in some circumstances, promote apoptosis.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).