Skip to product information
1 of 2

Biotinylated CD47 Fc&Avi Tag Protein, Human

Biotinylated CD47 Fc&Avi Tag Protein, Human

Catalog Number: UA010444 Reactivity: Human Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $490 USD
Regular price Sale price $490 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CD47, MER6, IAP, OA3
Accession Q08722
Amino Acid Sequence

Gln19-Pro139, with C-terminal Human IgG1 Fc & Avi Tag QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight 55-65kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135.

2、Oldenborg P A. (2004) Role of CD47 in erythroid cells and in autoimmunity. Leuk Lymphoma. 45(7): 1319-27.

3、Kaczorowski D J. et al. (2007) Targeting CD47: NO limit on therapeutic potential. Circ Res. 100(5): 602-603.

Background

The leukocyte surface antigen CD47 is also known as OA3, integrin-related protein (IAP), and protein MER6. Human CD47 is an integral membrane protein consisting of a 123-amino acid (aa) extracellular domain (ECD) and a single Ig-like domain, five transmembrane regions with short insertion loops, and a 34-aa C-terminal cytoplasmic tail. CD47 is widely distributed in normal adult tissues. CD47 is a receptor for SIRPA, and binding to SIRPA prevents the maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells, thereby protecting cancer cells from elimination by phagocytosis. The interaction between CD47 and SIRPG mediates cell-cell adhesion, enhances superantigen-dependent t cell-mediated proliferation, and co-stimulates t cell activation. CD47 is highly expressed in a variety of solid tumor cells and malignant hematological tumor cells, and its expression level is positively correlated with disease progression.

Picture

Bioactivity

Immobilized SIRP-α Fc Chimera, Human (Cat. No. UA010005) at 2.0μg/mL (100μL/well) can bind Biotinylated CD47 Fc&Avi Tag, Human (Cat. No. UA010444) with EC50 of 45.92-64.38 ng/mL. 

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).