Skip to product information
1 of 2

Biotinylated B7-1 Avi&His Tag Protein, Human

Biotinylated B7-1 Avi&His Tag Protein, Human

Catalog Number: UA010539 Reactivity: Human Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $592 USD
Regular price Sale price $592 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen B7-1
Synonyms CD80, B7, B7-1, B7.1, BB1, CD28LG, CD28LG1, LAB7
Accession P33681-1
Amino Acid Sequence

Val35-Asn242, with C-terminal Avi&His Tag VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGGGSGLNDIFEAQKIEWHEHHHHHHHH

Expression System HEK293
Molecular Weight

43-55kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Carin C. Stamper, Yan Zhang, James F. Tobin, David V. Erbe, Shinji Ikemizu, Simon J. Davis, Mark L. Stahl, Jasbir Seehra, William S. Somers & Lidia Mosyak: Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses, Nature volume 410, pages608-611 (2001).

Background

As the first identified B7 family member, CD80 is widely expressed in a broad spectrum of tissues, even on some malignant tumor cells, thereby suggesting the potential mechanism of immune evasion of tumor cells.CD80 is recognized as one of the most potent costimulatory molecules by which immune cells limit malignant growth. It is upregulated upon cell stress and it is critical for efficacious immune surveillance during carcinogenesis. Low surface expression of CD80 was reported as an immune escape mechanism of colon carcinoma; on the other hand, its expression resulted enhanced in high-frequency microsatellite instability (MSI) colorectal cancers, a CRC subtype which is highly immunogenic and associated with a better prognosis. Both in vivo and in vitro studies showed that the upregulation of CD80 on tumor cell surface successfully activates antitumor immune responses, while its expression is frequently lost during tumor progression probably due to selective pressure by the immune system. Thus, to develop effective approaches for cancer immunotherapy, strategies for enhancing CD80 expression in tumors are urgently required.

Picture

SDS-PAGE

1 μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized Biotinylated B7-1 Avi&His Tag Protein, Human (Cat. No. UA010539) at 2 μg/mL on Streptavidin precoated (0.5μg/well) plate, can bind CTLA-4 Fc Chimera Protein, Human (Cat. No. UA010039) with EC50 of 0.74-1.19ng/ml.