Skip to product information
1 of 1

Human STAB1 Protein, His Tag

Human STAB1 Protein, His Tag

Catalog Number: S0A6080 Brand: Starter
Price:
Regular price $45 USD
Regular price Sale price $45 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Stabilin-1, Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1 (FEEL-1), MS-1 antigen, FEEL1, KIAA0246
Accession Q9NY15
Amino Acid Sequence

Protein sequence (Q9NY15, Asp638-Leu1024, with C-His Tag) DGILLPPTILPILPKHCSEEQHKIVAGSCVDCQALNTSTCPPNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTIMEQGCCKGFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGEQCQEDCGCVHGLCDNRPGSGGVCQQGTCAPGFSGRFCNESMGDCGPTGLAQHCHLHARCVSQEGVARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGRVCVAIDECELDMRGGCHTDALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHGLATCRAVGGGQRVCTCPPGFGGDGFSCYGDIFRELEANAHFSIFYQWLKSAGITLPADRRVTAL

Expression System CHO Stable Cells
Molecular Weight Predicted MW: 42.3 kDaObserved MW: 55-60 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Stabilin-1 is a large transmembrane glycoprotein primarily expressed on macrophages, sinusoidal endothelial cells (e.g., in liver and spleen), and certain tumor-associated macrophages. It functions as a scavenger receptor and endocytic receptor, mediating the clearance of various ligands from blood and tissue fluids, including acetylated/low-density lipoproteins, advanced glycation end-products (AGEs), and apoptotic cells. By removing harmful molecules and cellular debris, Stabilin-1 contributes to tissue homeostasis, inflammation resolution, and immune regulation. It is also involved in cell adhesion, angiogenesis, and lymphatic vessel development. Dysregulation of Stabilin-1 has been linked to inflammatory diseases, atherosclerosis, and cancer progression, as it facilitates immune evasion in tumors.

Picture

SDS-PAGE

2μg(R: reducing conditions)