1 3

Human TNF-alpha, His Tag

Human TNF-alpha, His Tag

Catalog Number: S0A4004 Brand: Starter
Share:
Price:
$250 USD
$250 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P01375
Amino Acid Sequence

VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALGGGGSHHHHHHHHHH.
Expression System HEK293
Molecular Weight

19.0 kDa (reducing)
Purity ＞95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Picture

Bioactivity

Immobilized Human TNF-alpha, His Tag at 4 μg/mL (50 μL/well) can bind Biotinylated TNFR1/CD120a/TNFRSF1A His&Avi Tag, Human (Cat. No. UA010790) with EC50 of 8.596-12.17 ng/ml.

Immobilized Human TNF-alpha, His Tag at 1 μg/mL (100 μL/well) can bind Anti-TNF-α Monoclonal Antibody (Adalimumab) (Cat. No. S0B0553) with EC50 of 0.323-0.599 ng/mL.

SDS-PAGE