Immobilized Recombinant Human OX40 (C-Fc) at 4 μg/mL (50 μL/well) can bind Human OX40L/TNFSF4/CD252, His tag with EC50 of 3.341-4.486 ng/ ml.
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand (OX40L), TAX transcriptionally-activated glycoprotein 1, TXGP1 |
| Accession | P23510 |
| Amino Acid Sequence | Protein sequence (P23510, Gln51-Leu183, with C-His tag)QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 17.1 kDaObserved MW: 19-26 kDa |
| Purity | >90% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Tag | with C-His Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
OX40L is the ligand for OX40 and is stably expressed on many antigen-presenting cells such as DC2s (a subtype of dendritic cells), macrophages, and activated B lymphocytes. The ligation of OX40-OX40L is a source of survival signal for T cells and enables the development of memory T cells. Signaling through these two molecules also leads to polarization towards Th2 immune response even in an environment with low levels of IL-4 cytokine. OX40L is also present on the surface of many non-immune cells, for example, endothelial cells and smooth muscle cells. The surface expression of OX40L is induced by many pro-inflammatory mediators, such as TNF-α, e.g. produced by mast cells, IFN-γ and PGE2. Various single-nucleotide polymorphisms (SNPs) of the OX40L gene have been identified. For some of them association with systemic lupus erythematosus has been reported.
Picture
Picture
Bioactivity
Immobilized OX40/TNFRSF4/CD134 Fc Chimera, Cynomolgus (Cat. No. UA010869) at 8 μg/mL (50 μL/well) can bind Human OX40L/TNFSF4/CD252, His tag with EC50 of 10.33-14.06 ng/ ml.
SDS-PAGE
2 μg(R: reducing conditions)
