Skip to product information
1 of 1

Spike RBD His Tag Protein, SARS-CoV-2(B.1.1.529/Omicron,N terminal)

Spike RBD His Tag Protein, SARS-CoV-2(B.1.1.529/Omicron,N terminal)

Catalog Number: UA030036 Reactivity: Viral Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $360 USD
Regular price Sale price $360 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species SARS-CoV-2
Accession P0DTC2
Amino Acid Sequence

Arg319-Phe541, with N-terminal 8*His HHHHHHHHGGGGSDYKDDDDKRVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVSGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLRSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Expression System HEK293
Molecular Weight

35-43kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Coronaviruses (CoVs) are enveloped viruses with a positive sense RNA genome, that belong to the subfamily Coronavirinae within the family Coronaviridae, which is part of the Nidovirales order. The CoVs virion contains at least four structural proteins: spike (S), envelope (E), membrane (M) and nucleocapsid (N). Among them, the S protein plays an essential role in viral attachment, fusion, entry, and transmission. It comprises an N-terminal S1 subunit responsible for virus–receptor binding and a C-terminal S2 subunit responsible for virus–cell membrane fusion. S1 is further divided into an N-terminal domain (NTD) and a receptor-binding domain (RBD). During infection, CoV first binds the host cell through interaction between its S1-RBD and the cell membrane receptor, triggering conformational changes in the S2 subunit that result in virus fusion and entry into the target cell.

Picture

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).