Skip to product information
1 of 2

Human VEGF 121, His tag

Human VEGF 121, His tag

Catalog Number: S0A6029 Brand: Starter
Price:
Regular price $2,520 USD
Regular price Sale price $2,520 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P15692-9
Amino Acid Sequence

Protein sequence(P15692-9, Ala27-Arg147, with C-10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:15.7kDa Actual:16kDa

Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Vascular endothelial growth factor (VEGF-121) is a naturally-occurring VEGF-A splice variant involved in embryonic vasculogenesis and angiogenesis. VEGF binds to VEGFR-1 and VEGFR-2, and activates Raf/MEK/ERK and PI3K/AKT pathways. VEGF-121 is released as a freely diffusible protein by a variety of normal and transformed cells. It plays an important role in neurogenesis both in vitro and in vivo. It has neurotrophic effects on neurons of the central nervous system and promotes growth and survival of dopaminergic neurons and astrocytes. VEGF also promotes growth and survival of vascular endothelial cells, monocyte chemotaxis, and colony formation by granulocyte-macrophage progenitor cells.

Picture

Bioactivity

Immobilized Human VEGF 121, His Tag at 4 μg/mL (50 μL/well) can bind VEGF-R2/KDR Fc Chimera Protein, Human (Cat. No. UA010144) with EC50 of 17.8-21.8 ng/mL.

SDS-PAGE

2μg(R: reducing conditions)