Skip to product information
1 of 3

Human BCMA/TNFRSF17 Protein, His Tag

Human BCMA/TNFRSF17 Protein, His Tag

Catalog Number: S0A1156 Brand: Starter
Price:
Regular price $85 USD
Regular price Sale price $85 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Tumor necrosis factor receptor superfamily member 17, B-cell maturation protein, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Protein sequence (Q02223-1, Met1-Ala54, with C-His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Expression System HEK293
Molecular Weight Predicted MW: 5.9 kDaObserved MW: 10, 13 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Picture

FC

2e5 of transient transfected anti-BCMA ScFv CAR-293 cells were stained with 1ug Human BCMA/TNFRSF17 Protein, His Tag and unlable respectively (Fig. C and B), and non-transfected 293 cells were used as a control (Fig. A). Alexa Fluor 647 signal was used to evaluate the binding activity. 2e5 of transient transfected anti- BCMA ScFv CAR-293 cells were stained with isotype and Whitlow/218 Linker-Alexa Fluor® 488 (Fig. E and D). Alexa Fluor® 488 signal was used to evaluate the binding activity.

Bioactivity

Immobilized Human BCMA/TNFRSF17 Protein, His Tag at 2 μg/mL (100 μL/well) can bind Human TNFSF13B/BAFF/CD257 Protein, hFc tag (Cat. No. S0A1143) with EC50 of 4.5-6.2 ng/ml.

SDS-PAGE

2μg(R: reducing conditions)