Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | SerpinB3, SCCA1;Serpin B3, Protein T4-A, Squamous cell carcinoma antigen 1, SCCA-1,serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3, serpin peptidase inhibitor, clade B (ovalbumin), member 3, Squamous cell carcinoma antigen 1, T4-A,SCCA1 |
| Accession | P29508 |
| Amino Acid Sequence | MHHHHHHDDDDKNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP |
| Expression System | E.coli |
| Molecular Weight | 45.9 kDa |
| Purity | >90%, by SDS-PAGE under reducing conditions |
| Endotoxin | <2EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | 20mM Tris-HCl, 150mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
SerpinB3/SCCA belongs to tumor-related glycoprotein antigen, also known as TA-4 antigen, which widely exists in the cytoplasm of uterine, cervical, lung and other squamous cell carcinoma, and has a high content in non-keratinized cancer cells, which is closely related to the occurrence and development of squamous cell carcinoma. In normal squamous epithelial cells, SerpinB3/SCCA inhibits apoptosis and participates in the differentiation of squamous epithelium, but participates in the physiological processes such as invasion, metastasis and recurrence of cancer cells in tumor cells. As a specific marker of squamous cell carcinoma, the concentration of SerpinB3/SCCA increases with the aggravation of the disease, and it is an important tumor marker reflecting the biological characteristics of squamous cell carcinoma. Its serum level is widely used in the diagnosis of squamous cell carcinoma of many organs and clinical evaluation of therapeutic effect.
Protocol
Assay protocol
Principle: Measured by its ability to inhibit active Cathepsin L cleavage of a fluorogenic peptide substrate Z-LR-AMC.
Materials
1.Assay Buffer: 50 mM MES, 5 mM DTT, pH 6.0
2.SerpinB3/SCCA Protein, Human
3.Recombinant Human Cathepsin L
4.Substrate: Z-Leu-Arg-AMC (Catalog # ES008)
5.96 ELISA Removable Plate, Black, High binding (GENEVER, Catalog # GMO2-96H)
6.Plate Reader (PerkinElmer, excitation 380 nm and emission 460 nm)
Produce
1.Dilute rhCathepsin L to 40 μg/mL in Assay Buffer.
2.Incubate 40 μg/mL rhCathepsin L for 15 minutes on ice to activate.
3.Dilute activated rhCathepsin L to 0.2 μg/mL in Assay Buffer.
4.Prepare a curve of rhSerpin B3 (MW = 45.9 KDa) in Assay Buffer. Make the following serial dilutions: Top Conc.=1000, 333, 111, 37, 12, 4, 1.4, 0.5, 0.15, 0.05 nM.
5.Combine 25 μL of each dilution with 25 μL of the 0.2 μg/mL rhCathepsin L. Include an enzyme control containing Assay Buffer in place of rhSerpin B3.
6.Incubate reaction mixtures at 37 °C for 15 minutes.
7.Dilute reactions by adding 200 μL Assay Buffer to each.
8.Dilute Substrate to 20 μM in Assay Buffer.
9.Load into a black well plate 50 μL of the diluted incubated mixtures and start the reaction by adding 50 μL substrate.
10.Read at excitation and emission wavelengths of 380 nm and 460 nM (top read), respectively, in kinetic mode for 10 minutes.
11.Derive the 50% inhibition concentration (IC50) value for rhSerpin B3 by plotting RFU/min vs. concentration with 4-PL fitting.
12.Calculate the specific activity for rhCathepsin L at each point using the following formula (if needed):
Specific Activity (pmol/min/µg) = |
Adjusted Vmax* (RFU/min) x Conversion Factor** (pmol/RFU) |
amount of enzyme (µg) |
*Adjusted for Substrate Blank
**Derived using calibration standard 7-amino, 4-Methyl Coumarin.
Picture
Picture
SDS-PAGE

RP-HPLC


