Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Ig gamma-3 chain C region,IgG3 Fc |
| Accession | P01860 |
| Amino Acid Sequence | ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 35-43 kDa(Reducing) |
| Purity | >95%, by SDS-PAGE under reducing conditions |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Immunoglobulin G (IgG) is a monomer immunoglobulin, mainly involved in secondary antibody reaction, plasma B cell synthesis and secretion, constitute 75% of human serum immunoglobulin. There are four subtypes of IgG antibody: IgG1, IgG2, IgG3 and IgG4, which decrease in turn in serum. The spatial structure of these four subtypes is similar and the heavy chain sequences of each subtype are highly homologous. IgG3 has an extended hinge region, and its core hinge region has 11 disulfide bonds, so it is unstable for protease cleavage. After pepsin cleavage, IgG3 is divided into two antigen binding sites F (ab) s and a highly conserved Fc segment, and the Fc segment has a highly conserved N-glycosylation site. Fc fragments have been shown to mediate phagocytosis, trigger inflammation, and target IgG to specific tissues. The binding ability of IgG3 to Fc γ Rs was the strongest, and the effects of ADCC, ADCP and CDC were stronger than that of IgG1.
Picture
Picture
SDS-PAGE

SPR

Anti-His antibody Immobilized on CM5 Chip captured Fc γ RIIa/CD32a(H167) His tag, Human (Cat. No. UA020002), can bind IgG3 Fc, Human (UA050005) with an affinity constant of 4.27μM as determined in SPR assay.
