Immobilized Human DKK-1, His tag at 1 μg/mL (50 μL/well) can bind DKK-1 Recombinant Rabbit mAb (SDT-232-288) (Cat. No. S0B3276) with EC50 of 8.520-9.722 ng/ml.
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Dickkopf-related protein 1, Dickkopf-1, Hdkk-1, SK |
| Accession | O94907 |
| Amino Acid Sequence | Protein sequence(O94907, Thr32-His266, with C-10*His)TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRHGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 27.4kDa Actual: 45kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized powder |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
DKK-1 is a member of the dickkopf family and is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the Wnt signaling pathway. DKK-1 is an antagonist of the Wnt/β-catenin signalling pathway that acts by isolating the LRP6 co-receptor so that it cannot aid in activating the WNT signaling pathway. Moreover, DKK-1 was demonstrated to antagonize the Wnt/β-catenin pathway via a reduction in β-catenin and an increase in OCT4 expression.This inhibition plays a key role in heart, head and forelimb development during anterior morphogenesis of the embryo. Elevated levels of DKK-1 in bone marrow, plasma and peripheral blood are associated with the presence of osteolytic bone lesions in patients with multiple myeloma. Due to the role of DKK-1 in inflammation induced bone loss DKK-1 is under investigation as target for therapeutic strategies in medicine and dentistry.
Picture
Picture
Bioactivity
SDS-PAGE

