Skip to product information
1 of 2

SARS-CoV-2 (BA.2.86/Omicron) RBD (V483), His tag

SARS-CoV-2 (BA.2.86/Omicron) RBD (V483), His tag

Catalog Number: S0A2074 Brand: Starter
Price:
Regular price $150 USD
Regular price Sale price $150 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species SARS-CoV-2
Synonyms Spike glycoprotein, E2, Peplomer protein
Accession P0DTC2
Amino Acid Sequence

Protein sequence (P0DTC2, Arg319-Lys537, with C-10*His)RVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIKGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYWYRLFRKSKLKPFERDISTEIYQAGNKPCKGVKGPNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 26.6 kDaObserved MW: 34-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

BA.2.86 is an Omicron subvariant of SARS-CoV-2, the virus that causes COVID-19. BA.2.86 is notable for having more than thirty mutations on its spike protein relative to BA.2. The subvariant, which was first detected in a sample from 24 July 2023, is of concern due to it having made an evolutionary jump on par with the evolutionary jump that the original Omicron variant had made relative to Wuhan-Hu-1, the reference strain first sequenced in Wuhan in December 2019. It is a mutation of BA.2, itself a very early mutation in the Omicron family. BA.2.86 was designated as a variant under monitoring by the World Health Organization on 17 August 2023. Sars-cov-2 infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.

Picture

Bioactivity

Immobilized Human ACE2, hFc tag (Cat. No. S0A0071) at 10 μg/mL (50 μL/well) can bind SARS-CoV-2 (BA.2.86/Omicron) RBD (V483), His tag with EC50 of 3.221-3.691 ng/ml.

SDS-PAGE

2 μg(R: reducing conditions)