Skip to product information
1 of 1

Rat CGA Protein, His Tag

Rat CGA Protein, His Tag

Catalog Number: S0A8016 Brand: Starter
Price:
Regular price $170 USD
Regular price Sale price $170 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Rat
Synonyms Glycoprotein hormones alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, Follicle-stimulating hormone alpha chain (FSH-alpha), Follitropin alpha chain, Luteinizing hormone alpha chain (LSH-alpha), Lutropin alpha chain, Thyroid-stimulating hormone alpha chain (TSH-alpha), Thyrotropin alpha chain, Cga1
Accession P11962
Amino Acid Sequence

Protein sequence (P11962, Leu25-Ser120, with C-His Tag) LPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS

Expression System HEK293
Molecular Weight Predicted MW: 12.3 kDaObserved MW: 24 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Glycoprotein hormones alpha chain (CGA) is a common subunit shared by several pituitary glycoprotein hormones, including thyroid-stimulating hormone (TSH), follicle-stimulating hormone (FSH), luteinizing hormone (LH), and chorionic gonadotropin (CG). It is encoded by a single gene and non-covalently associates with unique hormone-specific beta subunits to form biologically active heterodimers. This 14-20 kDa polypeptide is heavily modified by N-linked glycosylation, which is critical for proper protein folding, heterodimer assembly, and biological activity.

Picture

SDS-PAGE

2μg(R: reducing conditions)