Skip to product information
1 of 1

Mouse CD3 epsilon Protein, hFc tag

Mouse CD3 epsilon Protein, hFc tag

Catalog Number: S0A1136 Brand: Starter
Price:
Regular price $225 USD
Regular price Sale price $225 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms T-cell surface glycoprotein CD3 epsilon chain, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, Cd3e
Accession P22646
Amino Acid Sequence

Protein sequence (P22646, Asp23-Asp108, with C-hFc tag) DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD

Expression System HEK293
Molecular Weight

Predicted MW: 36 kDaObserved MW: 43 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD3e molecule, epsilon also known as CD3E. The protein is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause severe immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. T-cell surface glycoprotein CD3 epsilon chain has been shown to interact with TOP2B, CD3EAP and NCK2.

Picture

SDS-PAGE

3μg(R: reducing conditions)