Skip to product information
1 of 2

Mouse CD152, his tag

Mouse CD152, his tag

Catalog Number: S0A1066 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4), Cd152
Accession P09793
Amino Acid Sequence

Protein sequence (P09793, Glu36-Asp161, with C-10*His)EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 15.6 kDaObserved MW: 20-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CTLA-4 or CTLA4 (cytotoxic T-lymphocyte-associated protein 4), also known as CD152 (cluster of differentiation 152), is a protein receptor that functions as an immune checkpoint and downregulates immune responses. CTLA-4 is constitutively expressed in regulatory T cells but only upregulated in conventional T cells after activation – a phenomenon which is particularly notable in cancers. It acts as an "off" switch when bound to CD80 or CD86 on the surface of antigen-presenting cells. The CTLA-4 protein is encoded by the Ctla-4 gene in mice and the CTLA-4 gene in humans.

Picture

Bioactivity

Immobilized Recombinant Mouse B7-1 (C-Fc) at 4 μg/mL (50 μL/well) can bind Mouse CD152, his tag with EC50 of 16.27-21.58 ng/mL.

SDS-PAGE

2μg(R: reducing conditions)